General Information

  • ID:  hor005696
  • Uniprot ID:  Q91W27
  • Protein name:  Tuberoinfundibular peptide of 39 residues
  • Gene name:  Pth2
  • Organism:  Mus musculus (Mouse)
  • Family:  Parathyroid hormone family
  • Source:  Animal
  • Expression:  Expressed in testis and, less abundantly, in liver and kidney. Expressed in seminiferous tubuli and several brain regions, including nucleus ruber, caudal paralemniscal nucleus, nucleus centralis pontis, and nucleus subparafascicularis thalami. Expressed
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005102 signaling receptor binding
  • GO BP:  GO:0006171 cAMP biosynthetic process; GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SLALADDAAFRERARLLAALERRRWLDSYMQKLLLLDAP
  • Length:  39(62-100)
  • Propeptide:  METCQMSRSPRERLLLLLLLLLLVPWGTGPASGVALPLAGVFSLRAPGRAWAGLGSPLSRRSLALADDAAFRERARLLAALERRRWLDSYMQKLLLLDAP
  • Signal peptide:  METCQMSRSPRERLLLLLLLLLLVPWGTGP
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May also have a role in spermatogenesis. May activate nociceptors and nociceptive circuits.potentiate aspects of nociception within the spinal cord
  • Mechanism:  Plays a role as a potent and selective agonist of PTH2R resulting in adenyl cyclase activation and intracellular calcium levels elevation. Induces protein kinase C beta activation, recruitment of beta-arrestin and PTH2R internalization. May inhibit cell proliferation via its action on PTH2R activation.
  • Cross BBB:  NA
  • Target:  Pth2r
  • Target Unid:   Q91V95
  • IC50:  NA
  • EC50:  0.74nM
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q91W27-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005696_AF2.pdbhor005696_ESM.pdb

Physical Information

Mass: 520731 Formula: C202H332N60O56S
Absent amino acids: CGHINTV Common amino acids: L
pI: 9.29 Basic residues: 7
Polar residues: 3 Hydrophobic residues: 20
Hydrophobicity: -9.49 Boman Index: -8471
Half-Life / Aliphatic Index: 1.9 hour Aliphatic Index: 120.51
Instability Index: 7182.56 Extinction Coefficient cystines: 6990
Absorbance 280nm: 183.95

Literature

  • PubMed ID:  12098667
  • Title:  Characterization of the human and mouse genes encoding the tuberoinfundibular peptide of 39 residues, a ligand of the parathyroid hormone receptor family.
  • PubMed ID:  11818570
  • Title:  Anatomical and physiological evidence for involvement of tuberoinfundibular peptide of 39 residues
  • PubMed ID:  11861531
  • Title:  
  • PubMed ID:  12084532
  • Title: